PDB entry 1knb

View 1knb on RCSB PDB site
Description: crystal structure of the receptor-binding domain of adenovirus type 5 fiber protein at 1.7 angstroms resolution
Class: cell receptor recognition
Keywords: cell receptor recognition
Deposited on 1995-01-06, released 1995-03-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.158
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenovirus type 5 fiber protein
    Species: Human adenovirus 5 [TaxId:28285]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1knba_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1knbA (A:)
    tgaitvgnknndkltlwttpapspncrlnaekdakltlvltkcgsqilatvsvlavkgsl
    apisgtvqsahliirfdengvllnnsfldpeywnfrngdltegtaytnavgfmpnlsayp
    kshgktaksnivsqvylngdktkpvtltitlngtqetgdttpsaysmsfswdwsghnyin
    eifatssytfsyiaqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1knbA (A:)
    ndkltlwttpapspncrlnaekdakltlvltkcgsqilatvsvlavkgslapisgtvqsa
    hliirfdengvllnnsfldpeywnfrngdltegtaytnavgfmpnlsaypkshgktaksn
    ivsqvylngdktkpvtltitlngtqetgdttpsaysmsfswdwsghnyineifatssytf
    syiaqe