PDB entry 1kn9

View 1kn9 on RCSB PDB site
Description: crystal structure of a bacterial signal peptidase apo-enzyme, implications for signal peptide binding and the ser-lys dyad mechanism.
Class: hydrolase
Keywords: serine protease, Lysine general base, membrane protein, mostly beta-fold, HYDROLASE
Deposited on 2001-12-18, released 2002-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Signal peptidase I
    Species: Escherichia coli [TaxId:83333]
    Gene: LEPB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kn9a_
  • Chain 'B':
    Compound: Signal peptidase I
    Species: Escherichia coli [TaxId:83333]
    Gene: LEPB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kn9b_
  • Chain 'C':
    Compound: Signal peptidase I
    Species: Escherichia coli [TaxId:83333]
    Gene: LEPB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kn9c_
  • Chain 'D':
    Compound: Signal peptidase I
    Species: Escherichia coli [TaxId:83333]
    Gene: LEPB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kn9d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kn9A (A:)
    mvrsfiyepfqipsgsmmptlligdfilvekfaygikdpiyqktlietghpkrgdivvfk
    ypedpkldyikravglpgdkvtydpvskeltiqpgcssgqacenalpvtysnvepsdfvq
    tfsrrnggeatsgffevpknetkengirlserketlgdvthriltvpiaqdqvgmyyqqp
    gqqlatwivppgqyfmmgdnrdnsadsrywgfvpeanlvgrataiwmsfdkqegewptgl
    rlsriggih
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kn9A (A:)
    vrsfiyepfqipsgsmmptlligdfilvekfaygikdpiyqktlietghpkrgdivvfky
    pedpkldyikravglpgdkvtydpvskeltiqpgcssnalpvtysnvepsdfvqtfsrrn
    ggeatsgffevpknetkengirlserketlgdvthriltvpiaqdqvgmyyqqpgqqlat
    wivppgqyfmmgdnrdnsadsrywgfvpeanlvgrataiwmsfdlrlsriggih
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kn9B (B:)
    mvrsfiyepfqipsgsmmptlligdfilvekfaygikdpiyqktlietghpkrgdivvfk
    ypedpkldyikravglpgdkvtydpvskeltiqpgcssgqacenalpvtysnvepsdfvq
    tfsrrnggeatsgffevpknetkengirlserketlgdvthriltvpiaqdqvgmyyqqp
    gqqlatwivppgqyfmmgdnrdnsadsrywgfvpeanlvgrataiwmsfdkqegewptgl
    rlsriggih
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kn9B (B:)
    sfiyepfqipsgsmmptlligdfilvekfahpkrgdivvfkypedpkldyikravglpgd
    kvtydpvskeltiqpgcssgqacenalpvtysnvepsdfvqtfsrrnggeatsgffevpk
    netkengirlserketlgdvthriltvpiaqdqvgmyyqqpgqqlatwivppgqyfmmgd
    nrdnsadsrywgfvpeanlvgrataiwmsfdglrlsriggih
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1kn9C (C:)
    mvrsfiyepfqipsgsmmptlligdfilvekfaygikdpiyqktlietghpkrgdivvfk
    ypedpkldyikravglpgdkvtydpvskeltiqpgcssgqacenalpvtysnvepsdfvq
    tfsrrnggeatsgffevpknetkengirlserketlgdvthriltvpiaqdqvgmyyqqp
    gqqlatwivppgqyfmmgdnrdnsadsrywgfvpeanlvgrataiwmsfdkqegewptgl
    rlsriggih
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kn9C (C:)
    vrsfiyepfqipsgsmmptlligdfilvekfaygikdpiyqktlietghpkrgdivvfky
    pedpkldyikravglpgdkvtydpvskeltiqpgcssnalpvtysnvepsdfvqtfsrrn
    ggeatsgffevpknetkengirlserketlgdvthriltvpiaqdqvgmyyqqpgqqlat
    wivppgqyfmmgdnrdnsadsrywgfvpeanlvgrataiwmsfdlrlsriggih
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1kn9D (D:)
    mvrsfiyepfqipsgsmmptlligdfilvekfaygikdpiyqktlietghpkrgdivvfk
    ypedpkldyikravglpgdkvtydpvskeltiqpgcssgqacenalpvtysnvepsdfvq
    tfsrrnggeatsgffevpknetkengirlserketlgdvthriltvpiaqdqvgmyyqqp
    gqqlatwivppgqyfmmgdnrdnsadsrywgfvpeanlvgrataiwmsfdkqegewptgl
    rlsriggih
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kn9D (D:)
    sfiyepfqipsgsmmptlligdfilvekfpkrgdivvfkyedpkldyikravglpgdkvt
    ydpvskeltiqpgcssgqanalpvtysnvepsdfvqtfsrreatsgffevpknetkengi
    rlserketlgdvthriltvpiaqdqvgmyyqqpgqqlatwivppgqyfmmgdnrdnsads
    rywgfvpeanlvgrataiwmsfdglrlsriggih