PDB entry 1kn4

View 1kn4 on RCSB PDB site
Description: catalytic antibody d2.3 complex
Deposited on 2001-12-18, released 2002-03-13
The last revision prior to the SCOP 1.69 freeze date was dated 2002-03-13, with a file datestamp of 2002-03-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.213
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kn4H (H:)
    emqlqqsgaellrpgtsvklscktsgyiftsywihwvkqrsgqglewiariypgtgstyy
    nekfkgkatltadkssstaymqlstlksedsavyfctrwgfipvredyvmdywgqgtlvt
    vssakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavl
    qsdlytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kn4L (L:)
    divmtqspltlsvtigqpasisckssqsllysngktylnwllqrpgqspkrlihlvskld
    sgvpdritgsgsgtdftlkisrveaadlgvyycvqgthfpytfgggtkleilradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec