PDB entry 1kmz

View 1kmz on RCSB PDB site
Description: molecular basis of mitomycin c resictance in streptomyces: crystal structures of the mrd protein with and without a drug derivative
Class: antimicrobial protein
Keywords: Mitomycin C, antibiotic resistance, SAD, anomalous diffraction, domain swapping, p-staking, ANTIMICROBIAL PROTEIN
Deposited on 2001-12-17, released 2002-07-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.163
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: mitomycin-binding protein
  Species: Streptomyces lavendulae [TaxId:1914]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O05205 (Start-129)
  Domains in SCOPe 2.07: d1kmza_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1kmzA (A:)
  msarislfavvvedmakslefyrklgveipaeadsaphteavldggirlawdtvetvrsy
  dpewqaptgghrfaiafefpdtasvdkkyaelvdagyeghlkpwnavwgqryaivkdpdg
  nvvdlfaplp
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1kmzA (A:)
  arislfavvvedmakslefyrklgveipaeadsaphteavldggirlawdtvetvrsydp
  ewqaghrfaiafefpdtasvdkkyaelvdagyeghlkpwnavwgqryaivkdpdgnvvdl
  faplp