PDB entry 1kmp

View 1kmp on RCSB PDB site
Description: crystal structure of the outer membrane transporter feca complexed with ferric citrate
Deposited on 2001-12-17, released 2002-03-06
The last revision prior to the SCOP 1.61 freeze date was dated 2002-03-06, with a file datestamp of 2002-03-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.242
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1kmpa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kmpA (A:)
    ndvfehagardvirredfaktgattmrevlnripgvsapenngtgshdlamnfgirglnp
    rlasrstvlmdgipvpfapygqpqlslapvslgnmdaidvvrgggavrygpqsvggvvnf
    vtraipqdfgieagvegqlsptssqnnpkethnlmvggtadngfgtallysgtrgsdwre
    hsatriddlmlkskyapdevhtfnsllqyydgeadmpgglsradydadrwqstrpydrfw
    grrklaslgyqfqpdsqhkfniqgfytqtlrsgyleqgkritlsprnywvrgieprysqi
    fmigpsahevgvgyrylnesthemryytatssgqlpsgsspydrdtrsgteahawylddk
    idignwtitpgmrfehiesyqnnaitgtheevsynaplpalnvlyhltdswnlyantegs
    fgtvqysqigkavqsgnvepekartwelgtryddgaltaemglflinfnnqydsnqtndt
    vtargktrhtgletqarydlgtltptldnvsiyasyayvnaeirekgdtygnlvpfspkh
    kgtlgvdykpgnwtfnlnsdfqssqfadnantvkesadgstgripgfmlwgarvaydfgp
    qmadlnlafgvknifdqdyfirsyddnnkgiyagqprtlymqgslkf