PDB entry 1kmo

View 1kmo on RCSB PDB site
Description: crystal structure of the outer membrane transporter feca
Deposited on 2001-12-17, released 2002-03-06
The last revision prior to the SCOP 1.67 freeze date was dated 2002-03-06, with a file datestamp of 2002-03-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.207
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1kmoa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kmoA (A:)
    mtplrvfrkttplvntirlsllplaglsfsafaaqvniapgsldkalnqyaahsgftlsv
    dasltrgkqsnglhgdydvesglqqlldgsglqvkplgnnswtlepapapkedaltvvgd
    wlgdarendvfehagardvirredfaktgattmrevlnripgvsapenngtgshdlamnf
    girglnprlasrstvlmdgipvpfapygqpqlslapvslgnmdaidvvrgggavrygpqs
    vggvvnfvtraipqdfgieagvegqlsptssqnnpkethnlmvggtadngfgtallysgt
    rgsdwrehsatriddlmlkskyapdevhtfnsllqyydgeadmpgglsradydadrwqst
    rpydrfwgrrklaslgyqfqpdsqhkfniqgfytqtlrsgyleqgkritlsprnywvrgi
    eprysqifmigpsahevgvgyrylnesthemryytatssgqlpsgsspydrdtrsgteah
    awylddkidignwtitpgmrfehiesyqnnaitgtheevsynaplpalnvlyhltdswnl
    yantegsfgtvqysqigkavqsgnvepekartwelgtryddgaltaemglflinfnnqyd
    snqtndtvtargktrhtgletqarydlgtltptldnvsiyasyayvnaeirekgdtygnl
    vpfspkhkgtlgvdykpgnwtfnlnsdfqssqfadnantvkesadgstgripgfmlwgar
    vaydfgpqmadlnlafgvknifdqdyfirsyddnnkgiyagqprtlymqgslkf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kmoA (A:)
    altvvgdwlgdarendvfehagardvirredfaktgattmrevlnripgvsapenngtgs
    hdlamnfgirglnprlasrstvlmdgipvpfapygqpqlslapvslgnmdaidvvrggga
    vrygpqsvggvvnfvtraipqdfgieagvegqlsptssqnnpkethnlmvggtadngfgt
    allysgtrgsdwrehsatriddlmlkskyapdevhtfnsllqyydgeadmpgglsradyd
    adrwqstrpydrfwgrrklaslgyqfqpdsqhkfniqgfytqtlrsgyleqgkritlspr
    nywvrgieprysqifmigpsahevgvgyrylnesthemryytatssgqlpsgsspydrdt
    rsgteahawylddkidignwtitpgmrfehiesyqnnaitgtheevsynaplpalnvlyh
    ltdswnlyantegsfgtvqysqigkavqsgnvepekartwelgtryddgaltaemglfli
    nfnnqydsnqtndtvtargktrhtgletqarydlgtltptldnvsiyasyayvnaeirek
    gdtygnlvpfspkhkgtlgvdykpgnwtfnlnsdfqssqfadnantvkesadgstgripg
    fmlwgarvaydfgpqmadlnlafgvknifdqdyfirsyddnnkgiyagqprtlymqgslk
    f