PDB entry 1kmo

View 1kmo on RCSB PDB site
Description: Crystal structure of the Outer Membrane Transporter FecA
Class: membrane protein
Keywords: Membrane protein, Iron transporter, TonB-dependent receptor, Siderophore
Deposited on 2001-12-17, released 2002-03-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Iron(III) dicitrate transport protein fecA
    Species: Escherichia coli [TaxId:83333]
    Gene: fecA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1kmoa_
  • Heterogens: LDA, HTO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kmoA (A:)
    mtplrvfrkttplvntirlsllplaglsfsafaaqvniapgsldkalnqyaahsgftlsv
    dasltrgkqsnglhgdydvesglqqlldgsglqvkplgnnswtlepapapkedaltvvgd
    wlgdarendvfehagardvirredfaktgattmrevlnripgvsapenngtgshdlamnf
    girglnprlasrstvlmdgipvpfapygqpqlslapvslgnmdaidvvrgggavrygpqs
    vggvvnfvtraipqdfgieagvegqlsptssqnnpkethnlmvggtadngfgtallysgt
    rgsdwrehsatriddlmlkskyapdevhtfnsllqyydgeadmpgglsradydadrwqst
    rpydrfwgrrklaslgyqfqpdsqhkfniqgfytqtlrsgyleqgkritlsprnywvrgi
    eprysqifmigpsahevgvgyrylnesthemryytatssgqlpsgsspydrdtrsgteah
    awylddkidignwtitpgmrfehiesyqnnaitgtheevsynaplpalnvlyhltdswnl
    yantegsfgtvqysqigkavqsgnvepekartwelgtryddgaltaemglflinfnnqyd
    snqtndtvtargktrhtgletqarydlgtltptldnvsiyasyayvnaeirekgdtygnl
    vpfspkhkgtlgvdykpgnwtfnlnsdfqssqfadnantvkesadgstgripgfmlwgar
    vaydfgpqmadlnlafgvknifdqdyfirsyddnnkgiyagqprtlymqgslkf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kmoA (A:)
    altvvgdwlgdarendvfehagardvirredfaktgattmrevlnripgvsapenngtgs
    hdlamnfgirglnprlasrstvlmdgipvpfapygqpqlslapvslgnmdaidvvrggga
    vrygpqsvggvvnfvtraipqdfgieagvegqlsptssqnnpkethnlmvggtadngfgt
    allysgtrgsdwrehsatriddlmlkskyapdevhtfnsllqyydgeadmpgglsradyd
    adrwqstrpydrfwgrrklaslgyqfqpdsqhkfniqgfytqtlrsgyleqgkritlspr
    nywvrgieprysqifmigpsahevgvgyrylnesthemryytatssgqlpsgsspydrdt
    rsgteahawylddkidignwtitpgmrfehiesyqnnaitgtheevsynaplpalnvlyh
    ltdswnlyantegsfgtvqysqigkavqsgnvepekartwelgtryddgaltaemglfli
    nfnnqydsnqtndtvtargktrhtgletqarydlgtltptldnvsiyasyayvnaeirek
    gdtygnlvpfspkhkgtlgvdykpgnwtfnlnsdfqssqfadnantvkesadgstgripg
    fmlwgarvaydfgpqmadlnlafgvknifdqdyfirsyddnnkgiyagqprtlymqgslk
    f