PDB entry 1kmh

View 1kmh on RCSB PDB site
Description: Crystal Structure of spinach chloroplast F1-ATPase complexed with tentoxin
Class: hydrolase
Keywords: Protein-Inhibitor Complex, HYDROLASE
Deposited on 2001-12-16, released 2002-03-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.4 Å
R-factor: 0.298
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATPase alpha subunit
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1kmha1, d1kmha2, d1kmha3
  • Chain 'B':
    Compound: ATPase beta subunit
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1kmhb1, d1kmhb2, d1kmhb3
  • Heterogens: TTX

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kmhA (A:)
    matiradeiskiireriegynrevkvvntgtvlqvgdgiarihgldevmagelvefeegt
    igialnlesnnvgvvlmgdglmiqegssvkatgriaqipvseaylgrvinalakpidgrg
    eitasesrliespapgimsrrsvyeplqtgliaidamipvgrgqreliigdrqtgktava
    tdtilnqqgqnvicvyvaigqkassvaqvvtnfqergameytivvaetadspatlqylap
    ytgaalaeyfmyrerhtliiyddlskqaqayrqmslllrrppgreaypgdvfylhsrlle
    raaklssllgegsmtalpivetqagdvsayiptnvisitdgqiflsadlfnagirpainv
    gisvsrvgsaaqikamkkvagklklelaqfaeleafaqfasdldkatqnqlargqrlrel
    lkqpqsapltveeqvmtiytgtngyldsleldqvrkylvelrtyvktnkpefqeiisstk
    tfteeaeallkeaiqeqmerfllqeqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kmhA (A:)
    kvvntgtvlqvgdgiarihgldevmagelvefeegtigialnlesnnvgvvlmgdglmiq
    egssvkatgriaqipvseaylgrvinalakpidgrgeitasesrliespapgimsrrsvy
    eplqtgliaidamipvgrgqreliigdrqtgktavatdtilnqqgqnvicvyvaigqkas
    svaqvvtnfqergameytivvaetadspatlqylapytgaalaeyfmyrerhtliiyddl
    skqaqayrqmslllrrppgreaypgdvfylhsrlleraaklssllgegsmtalpivetqa
    gdvsayiptnvisitdgqiflsadlfnagirpainvgisvsrvgsaaqikamkkvagklk
    lelaqfaeleafaqfasdldkatqnqlargqrlrellkqpqsapltveeqvmtiytgtng
    yldsleldqvrkylvelrtyvktnkpefqeiisstktfteeaeallkeaiqeqmerf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kmhB (B:)
    mrinpttsdpgvstlekknlgriaqiigpvlnvafppgkmpniynalivkgrdtagqpmn
    vtcevqqllgnnrvravamsatdgltrgmevidtgaplsvpvggptlgrifnvlgepvdn
    lrpvdtrttspihrsapaftqldtklsifetgikvvnllapyrrggkiglfggagvgktv
    limelinniakahggvsvfggvgertregndlymemkesgvineqniaeskvalvygqmn
    eppgarmrvgltaltmaeyfrdvneqdvllfidnifrfvqagsevsallgrmpsavgyqp
    tlstemgslqeritstkegsitsiqavyvpaddltdpapattfahldattvlsrglaakg
    iypavdpldststmlqprivgeehyeiaqrvketlqrykelqdiiailgldelseedrlt
    vararkierflsqpffvaevftgspgkyvglaetirgfqlilsgeldslpeqafylvgni
    deatakamnlemesklkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kmhB (B:)
    nlgriaqiigpvlnvafppgkmpniynalivkgrdtagqpmnvtcevqqllgnnrvrava
    msatdgltrgmevidtgaplsvpvggptlgrifnvlgepvdnlrpvdtrttspihrsapa
    ftqldtklsifetgikvvnllapyrrggkiglfggagvgktvlimelinniakahggvsv
    fggvgertregndlymemkesgvineqniaeskvalvygqmneppgarmrvgltaltmae
    yfrdvneqdvllfidnifrfvqagsevsallgrmpsavgyqptlstemgslqeritstke
    gsitsiqavyvpaddltdpapattfahldattvlsrglaakgiypavdpldststmlqpr
    ivgeehyeiaqrvketlqrykelqdiiailgldelseedrltvararkierflsqpffva
    evftgspgkyvglaetirgfqlilsgeldslpeqafylvgnideata