PDB entry 1kmd

View 1kmd on RCSB PDB site
Description: solution structure of the vam7p px domain
Class: endocytosis/exocytosis
Keywords: PX domain, Vam7p, phosphoinositide binding, ENDOCYTOSIS/EXOCYTOSIS COMPLEX
Deposited on 2001-12-14, released 2002-06-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vacuolar morphogenesis protein VAM7
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1kmda_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kmdA (A:)
    kmseklrikvddvkinpkyvlygvstpnkrlykrysefwklktrlerdvgstipydfpek
    pgvldrrwqrryddpemiderriglerflnelyndrfdsrwrdtkiaqdflqlskpn