PDB entry 1km9

View 1km9 on RCSB PDB site
Description: The Structure of a Cytotoxic Ribonuclease From the Oocyte of Rana Catesbeiana (Bullfrog)
Class: hydrolase
Keywords: RC-RNase, HYDROLASE
Deposited on 2001-12-14, released 2003-09-09
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.178
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease, oocytes
    Species: Rana catesbeiana [TaxId:8400]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11916 (0-110)
      • modified residue (0)
    Domains in SCOPe 2.02: d1km9a_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1km9A (A:)
    enwatfqqkhiintpiincntimdnniyivggqckrvntfiissattvkaictgvinmnv
    lsttrfqlntctrtsitprpcpyssrtetnyicvkcenqypvhfagigrcp