PDB entry 1km9

View 1km9 on RCSB PDB site
Description: The Structure of a Cytotoxic Ribonuclease From the Oocyte of Rana Catesbeiana (Bullfrog)
Class: hydrolase
Keywords: RC-RNase, HYDROLASE
Deposited on 2001-12-14, released 2003-09-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ribonuclease, oocytes
  Species: Rana catesbeiana [TaxId:8400]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P11916 (0-110)
  Domains in SCOPe 2.08: d1km9a_
• Heterogens: PO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1km9A (A:)
  enwatfqqkhiintpiincntimdnniyivggqckrvntfiissattvkaictgvinmnv
  lsttrfqlntctrtsitprpcpyssrtetnyicvkcenqypvhfagigrcp