PDB entry 1km7

View 1km7 on RCSB PDB site
Description: Solution Structure and Backbone Dynamics of GABARAP, GABAA Receptor Associated Protein
Class: protein binding
Keywords: ubiquitin-like fold, PROTEIN BINDING
Deposited on 2001-12-14, released 2003-10-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GABA(A) Receptor associated protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1km7a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1km7A (A:)
    mkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvpsdltvgqf
    yflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdesvygl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1km7A (A:)
    gekirkkypdrvpvivekapkarigdldkkkylvpsdltvgqfyflirkrihlraedalf
    ffvnnvipptsatmgqlyqehheedfflyiaysdesvygl