PDB entry 1km6

View 1km6 on RCSB PDB site
Description: crystal structure of odcase mutant d70ak72a complexed with omp
Deposited on 2001-12-13, released 2002-06-28
The last revision prior to the SCOP 1.61 freeze date was dated 2002-06-28, with a file datestamp of 2002-06-28.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.17
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1km6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1km6A (A:)
rlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiaafav
adipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpgaem
fiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdpgetl
rfadaiivgrsiyladnpaaaaagiiesi