PDB entry 1km5

View 1km5 on RCSB PDB site
Description: Crystal structure of ODCase mutant D75N complexed with 6-azaUMP
Class: lyase
Keywords: TIM barrel, LYASE
Deposited on 2001-12-13, released 2002-06-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.165
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • engineered (74)
      • engineered (100)
    Domains in SCOPe 2.06: d1km5a_
  • Heterogens: CL, UP6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1km5A (A:)
    mrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvanipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gvgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdllipedpaankarkea
    elaaata
    

    Sequence, based on observed residues (ATOM records): (download)
    >1km5A (A:)
    vmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiad
    fkvanipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpg
    aemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdpg
    etlrfadaiivgrsiyladnpaaaaagiiesi