PDB entry 1km5

View 1km5 on RCSB PDB site
Description: crystal structure of odcase mutant d75n complexed with 6-azaump
Deposited on 2001-12-13, released 2002-06-28
The last revision prior to the SCOP 1.61 freeze date was dated 2002-06-28, with a file datestamp of 2002-06-28.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.165
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1km5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1km5A (A:)
vmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiad
fkvanipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpg
aemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdpg
etlrfadaiivgrsiyladnpaaaaagiiesi