PDB entry 1km1

View 1km1 on RCSB PDB site
Description: orotidine monophosphate decarboxylase mutant s127a crystal structure
Deposited on 2001-12-13, released 2002-06-28
The last revision prior to the SCOP 1.71 freeze date was dated 2002-06-28, with a file datestamp of 2002-06-28.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.177
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1km1a_
  • Chain 'B':
    Domains in SCOP 1.71: d1km1b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1km1A (A:)
    mrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemahpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gvgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdllipedpaankarkea
    elaaata
    

    Sequence, based on observed residues (ATOM records): (download)
    >1km1A (A:)
    vmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiad
    fkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemahpg
    aemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdpg
    etlrfadaiivgrsiyladnpaaaaagiiesi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1km1B (B:)
    mrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemahpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gvgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdllipedpaankarkea
    elaaata
    

    Sequence, based on observed residues (ATOM records): (download)
    >1km1B (B:)
    vmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiad
    fkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemahpg
    aemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdpg
    etlrfadaiivgrsiyladnpaaaaagiies