PDB entry 1klz

View 1klz on RCSB PDB site
Description: Crystal structure of orotidine monophosphate decarboxylase mutant D70A complexed with UMP
Class: lyase
Keywords: TIM barrel, LYASE
Deposited on 2001-12-13, released 2002-06-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.174
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • engineered (69)
      • engineered (100)
    Domains in SCOPe 2.06: d1klza_
  • Heterogens: CL, U, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1klzA (A:)
    mrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiaafkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gvgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdllnpedpaankarkea
    elaaata
    

    Sequence, based on observed residues (ATOM records): (download)
    >1klzA (A:)
    rlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiaafkv
    adipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpgaem
    fiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdpgetl
    rfadaiivgrsiyladnpaaaaagiiesi