PDB entry 1klv

View 1klv on RCSB PDB site
Description: Solution Structure and Backbone Dynamics of GABARAP, GABAA Receptor associated protein
Class: protein binding
Keywords: ubiquitin-like fold, PROTEIN BINDING
Deposited on 2001-12-13, released 2003-10-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GABA(A) Receptor associated protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1klva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1klvA (A:)
mkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvpsdltvgqf
yflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdesvygl

    Sequence, based on observed residues (ATOM records): (download) 
    >1klvA (A:)
gekirkkypdrvpvivekapkarigdldkkkylvpsdltvgqfyflirkrihlraedalf
ffvnnvipptsatmgqlyqehheedfflyiaysdesvygl