PDB entry 1klt

View 1klt on RCSB PDB site
Description: crystal structure of pmsf-treated human chymase at 1.9 angstroms resolution
Class: serine protease
Keywords: serine protease, hydrolase, mast cell, angiotensin, alpha toluenesulfonic acid
Deposited on 1997-10-16, released 1998-12-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.183
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Chymase
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P23946 (0-225)
    • engineered (6)
  Domains in SCOPe 2.08: d1klta_
• Heterogens: PMS, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kltA (A:)
  iiggteskphsrpymayleivtsngpskfcggflirrnfvltaahcagrsitvtlgahni
  teeedtwqklevikqfrhpkyntstlhhdimllklkekasltlavgtlpfpsqfnfvppg
  rmcrvagwgrtgvlkpgsdtlqevklrlmdpqacshfrdfdhnlqlcvgnprktksafkg
  dsggpllcagvaqgivsygrsdakppavftrishyrpwinqilqan