PDB entry 1klq

View 1klq on RCSB PDB site
Description: The Mad2 Spindle Checkpoint Protein Undergoes Similar Major Conformational Changes upon Binding to Either Mad1 or Cdc20
Class: cell cycle
Keywords: protein-peptide complex, MAD2 FAMILY, CELL CYCLE
Deposited on 2001-12-12, released 2002-01-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mitotic spindle assembly checkpoint protein mad2a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13257 (0-196)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d1klqa1, d1klqa2
  • Chain 'B':
    Compound: Mad2-binding peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1KLQ (0-End)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1klqA (A:)
    gsitlrgsaeivaeffsfginsilyqrgiypsetftrvqkygltllvttdlelikylnnv
    veqlkdwlykcsvqklvvvisniesgevlerwqfdiecdktakddsapreksqkaiqdei
    rsvirqitatvtflpllevscsfdlliytdkdlvvpekweesgpqfitnseevrlrsftt
    tihkvnsmvaykipvnd
    

  • Chain 'B':
    No sequence available.