PDB entry 1klp

View 1klp on RCSB PDB site
Description: The Solution Structure of Acyl Carrier Protein from Mycobacterium tuberculosis
Class: ligand transport
Keywords: four-helix bundle, LIGAND TRANSPORT
Deposited on 2001-12-12, released 2002-06-07
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: meromycolate extension acyl carrier protein
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: acpM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1klpa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1klpA (A:)
    mpvtqeeiiagiaeiieevtgiepseitpeksfvddldidslsmveiavqtedkygvkip
    dedlaglrtvgdvvayiqkleeenpeaaqalrakiesenpdavanvqarleaesk