PDB entry 1klp

View 1klp on RCSB PDB site
Description: The Solution Structure of Acyl Carrier Protein from Mycobacterium tuberculosis
Deposited on 2001-12-12, released 2002-06-07
The last revision prior to the SCOP 1.71 freeze date was dated 2002-06-07, with a file datestamp of 2002-06-07.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1klpa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1klpA (A:)
    mpvtqeeiiagiaeiieevtgiepseitpeksfvddldidslsmveiavqtedkygvkip
    dedlaglrtvgdvvayiqkleeenpeaaqalrakiesenpdavanvqarleaesk