PDB entry 1klo

View 1klo on RCSB PDB site
Description: crystal structure of three consecutive laminin-type epidermal growth factor-like (le) modules of laminin gamma1 chain harboring the nidogen binding site
Class: glycoprotein
Keywords: glycoprotein
Deposited on 1996-02-02, released 1997-08-20
The last revision prior to the SCOP 1.73 freeze date was dated 1997-08-20, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.1972
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: laminin
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1kloa1, d1kloa2, d1kloa3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kloA (A:)
    cpcpggsscaivpktkevvcthcptgtagkrcelcddgyfgdplgsngpvrlcrpcqcnd
    nidpnavgncnrltgeclkciyntagfycdrckegffgnplapnpadkckacacnpygtv
    qqqsscnpvtgqcqclphvsgrdcgtcdpgyynlqsgqgcer