PDB entry 1klo

View 1klo on RCSB PDB site
Description: crystal structure of three consecutive laminin-type epidermal growth factor-like (le) modules of laminin gamma1 chain harboring the nidogen binding site
Deposited on 1996-02-02, released 1997-08-20
The last revision prior to the SCOP 1.59 freeze date was dated 1997-08-20, with a file datestamp of 1997-08-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.1972
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1klo_ (-)
    cpcpggsscaivpktkevvcthcptgtagkrcelcddgyfgdplgsngpvrlcrpcqcnd
    nidpnavgncnrltgeclkciyntagfycdrckegffgnplapnpadkckacacnpygtv
    qqqsscnpvtgqcqclphvsgrdcgtcdpgyynlqsgqgcer