PDB entry 1kln

View 1kln on RCSB PDB site
Description: dna polymerase i klenow fragment (e.c.2.7.7.7) mutant/dna complex
Deposited on 1994-05-24, released 1994-11-30
The last revision prior to the SCOP 1.67 freeze date was dated 1994-11-30, with a file datestamp of 1994-12-07.
Experiment type: -
Resolution: 3.2 Å
R-factor: 0.23
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1klnA (A:)
    visydnyvtildeetlkawiaklekapvfafatetdsldnisanlvglsfaiepgvaayi
    pvahdyldapdqisreralellkplledekalkvgqnlkydrgilanygielrgiafdtm
    lesyilnsvagrhdmdslaerwlkhktitfeeiagkgknqltfnqialeeagryaaedad
    vtlqlhlkmwpdlqkhkgplnvfeniemplvpvlsrierngvkidpkvlhnhseeltlrl
    aelekkaheiageefnlsstkqlqtilfekqgikplkktpggapstseevleelaldypl
    pkvileyrglaklkstytdklplminpktgrvhtsyhqavtatgrlsstdpnlqnipvrn
    eegrrirqafiapedyvivsadysqielrimahlsrdkglltafaegkdihrataaevfg
    lpletvtseqrrsakainfgliygmsafglarqlniprkeaqkymdlyferypgvleyme
    rtraqakeqgyvetldgrrlylpdikssngarraaaeraainapmqgtaadiikramiav
    dawlqaeqprvrmimqvhdelvfevhkddvdavakqihqlmenctrldvpllvevgsgen
    wdqah
    

    Sequence, based on observed residues (ATOM records): (download)
    >1klnA (A:)
    visydnyvtildeetlkawiaklekapvfafatetdsldnisanlvglsfaiepgvaayi
    pvahdyldapdqisreralellkplledekalkvgqnlkydrgilanygielrgiafdtm
    lesyilnsvagrhdmdslaerwlkhktitfeeiagkgknqltfnqialeeagryaaedad
    vtlqlhlkmwpdlqkhkgplnvfeniemplvpvlsrierngvkidpkvlhnhseeltlrl
    aelekkaheiageefnlssqlqtilfekqgikplktseevleelaldyplpkvileyrgl
    aklkstytdklplminpktgrvhtsyhqavtatgrlsstdpnlqnipvrneegrrirqaf
    iapedyvivsadysqielrimahlsrdkglltafaegkdihrataaevfglpletvtseq
    rrsakainfgliygmsafglarqlniprkeaqkymdlyferypgvleymertraqakeqg
    yvetldgrrlylpdikssngarraaaeraainapmqgtaadiikramiavdawlqaeqpr
    vrmimqvhdelvfevhkddvdavakqihqlmenctrldvpllvevgsgenwdqah