PDB entry 1klm

View 1klm on RCSB PDB site
Description: hiv-1 reverse transcriptase complexed with bhap u-90152
Deposited on 1997-03-17, released 1998-03-18
The last revision prior to the SCOP 1.71 freeze date was dated 1998-03-18, with a file datestamp of 1998-03-18.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.237
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1klmA (A:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlakllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelq
    aiylalqdsglevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahk
    giggneqvdklvsagirkvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1klmA (A:)
    ispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvf
    aikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpld
    edfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviy
    qymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtv
    qpivlpekdswtvndiqklvgklnwasqiypgikvrqlakllrgtkalteviplteeael
    elaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgah
    tndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpp
    lvklwyqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqa
    iylalqdsglevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpah
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1klmB (B:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1klmB (B:)
    etvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaikk
    kdstkwrklvdfrelnkrtqdfwhpaglkkkksvtvldvgdayfsvpldedfrkytafti
    psinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqymddlyvgsd
    leigqhrtkieelrqhllrwgltyelhpdkwtvqpivlpekdswtvndiqklvgklnwas
    qiypgikvrqlckllrgtkalteviplteeaelelaenreilkepvhgvyydpskdliae
    iqkqgqgqwtyqiyqepfknlktgkyarmrgahtndvkqlteavqkittesiviwgktpk
    fklpiqketwetwwteywqatwipewefvntpplvklwyqlekep