PDB entry 1kll

View 1kll on RCSB PDB site
Description: Molecular basis of mitomycin C resictance in streptomyces: Crystal structures of the MRD protein with and without a drug derivative
Class: antimicrobial protein
Keywords: Mitomycin C, antibiotic resistance, SAD, anomalous diffraction, crystal structure, domain swapping, p-staking, ANTIMICROBIAL PROTEIN
Deposited on 2001-12-12, released 2002-07-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.124
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: mitomycin-binding protein
  Species: Streptomyces lavendulae [TaxId:1914]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O05205 (Start-129)
    • cloning artifact (14)
    • engineered (18)
    • engineered (24)
  Domains in SCOPe 2.07: d1klla_
• Heterogens: MC, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1kllA (A:)
  msarislfavvvedmaksmefyrkmgveipaeadsaphteavldggirlawdtvetvrsy
  dpewqaptgghrfaiafefpdtasvdkkyaelvdagyeghlkpwnavwgqryaivkdpdg
  nvvdlfaplp
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1kllA (A:)
  arislfavvvedmaksmefyrkmgveipaeadsaphteavldggirlawdtvetvrsydp
  ewqaptgghrfaiafefpdtasvdkkyaelvdagyeghlkpwnavwgqryaivkdpdgnv
  vdlfaplp