PDB entry 1klk

View 1klk on RCSB PDB site
Description: crystal structure of pneumocystis carinii dihydrofolate reductase ternary complex with pt653 and nadph
Class: oxidoreductase
Keywords: Structure-based design, antifolate, AIDS, protein-inhibitor complex, OXIDOREDUCTASE, NADP, One-carbon metabolism
Deposited on 2001-12-12, released 2002-12-12
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-02-02, with a file datestamp of 2011-01-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.196
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Pneumocystis carinii [TaxId:4754]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1klka_
  • Heterogens: PMD, NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1klkA (A:)
    mnqqksltlivalttsygigrsnslpwklkkeisyfkrvtsfvptfdsfesmnvvlmgrk
    twesiplqfrplkgrinvvitrnesldlgngihsaksldhalellyrtygsessvqinri
    fviggaqlykaamdhpkldrimatiiykdihcdvffplkfrdkewssvwkkekhsdlesw
    vgtkvphgkinedgfdyefemwtrdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1klkA (A:)
    qksltlivalttsygigrsnslpwklkkeisyfkrvtsfvptfdsfesmnvvlmgrktwe
    siplqfrplkgrinvvitrnesldlgngihsaksldhalellyrtygsessvqinrifvi
    ggaqlykaamdhpkldrimatiiykdihcdvffplkfrdkewssvwkkekhsdleswvgt
    kvphgkinedgfdyefemwtrdl