PDB entry 1klf

View 1klf on RCSB PDB site
Description: fimh adhesin-fimc chaperone complex with d-mannose
Class: chaperone/adhesin complex
Keywords: adhesin-chaperone complex, mannose-bound, chaperone/adhesin complex complex
Deposited on 2001-12-11, released 2002-06-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-06-30, with a file datestamp of 2009-06-26.
Experiment type: XRAY
Resolution: 2.79 Å
R-factor: 0.239
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chaperone protein fimc
    Species: Escherichia coli [TaxId:562]
    Gene: fimC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31697 (0-204)
      • conflict (17)
    Domains in SCOPe 2.06: d1klfa1, d1klfa2
  • Chain 'B':
    Compound: FimH PROTEIN
    Species: Escherichia coli [TaxId:562]
    Gene: fimH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1klfb1, d1klfb2
  • Chain 'C':
    Compound: chaperone protein fimc
    Species: Escherichia coli [TaxId:562]
    Gene: fimC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31697 (0-204)
      • conflict (17)
    Domains in SCOPe 2.06: d1klfc1, d1klfc2
  • Chain 'D':
    Compound: FimH PROTEIN
    Species: Escherichia coli [TaxId:562]
    Gene: fimH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1klfd1, d1klfd2
  • Chain 'E':
    Compound: chaperone protein fimc
    Species: Escherichia coli [TaxId:562]
    Gene: fimC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31697 (0-204)
      • conflict (17)
    Domains in SCOPe 2.06: d1klfe1, d1klfe2
  • Chain 'F':
    Compound: FimH PROTEIN
    Species: Escherichia coli [TaxId:562]
    Gene: fimH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1klff1, d1klff2
  • Chain 'G':
    Compound: chaperone protein fimc
    Species: Escherichia coli [TaxId:562]
    Gene: fimC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31697 (0-204)
      • conflict (17)
    Domains in SCOPe 2.06: d1klfg1, d1klfg2
  • Chain 'H':
    Compound: FimH PROTEIN
    Species: Escherichia coli [TaxId:562]
    Gene: fimH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1klfh1, d1klfh2
  • Chain 'I':
    Compound: chaperone protein fimc
    Species: Escherichia coli [TaxId:562]
    Gene: fimC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31697 (0-204)
      • conflict (17)
    Domains in SCOPe 2.06: d1klfi1, d1klfi2
  • Chain 'J':
    Compound: FimH PROTEIN
    Species: Escherichia coli [TaxId:562]
    Gene: fimH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1klfj1, d1klfj2
  • Chain 'K':
    Compound: chaperone protein fimc
    Species: Escherichia coli [TaxId:562]
    Gene: fimC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31697 (0-204)
      • conflict (17)
    Domains in SCOPe 2.06: d1klfk1, d1klfk2
  • Chain 'L':
    Compound: FimH PROTEIN
    Species: Escherichia coli [TaxId:562]
    Gene: fimH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1klfl1, d1klfl2
  • Chain 'M':
    Compound: chaperone protein fimc
    Species: Escherichia coli [TaxId:562]
    Gene: fimC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31697 (0-204)
      • conflict (17)
    Domains in SCOPe 2.06: d1klfm1, d1klfm2
  • Chain 'N':
    Compound: FimH PROTEIN
    Species: Escherichia coli [TaxId:562]
    Gene: fimH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1klfn1, d1klfn2
  • Chain 'O':
    Compound: chaperone protein fimc
    Species: Escherichia coli [TaxId:562]
    Gene: fimC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31697 (0-204)
      • conflict (17)
    Domains in SCOPe 2.06: d1klfo1, d1klfo2
  • Chain 'P':
    Compound: FimH PROTEIN
    Species: Escherichia coli [TaxId:562]
    Gene: fimH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1klfp1, d1klfp2
  • Heterogens: MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1klfA (A:)
    gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
    alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsd
    agsnityrtindygaltpkmtgvme
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1klfB (B:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvptggcdvsardvtvtlpdypgsvp
    ipltvycaksqnlgyylsgttadagnsiftntasfspaqgvgvqltrngtiipanntvsl
    gavgtsavslgltanyartggqvtagnvqsiigvtfvyq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1klfC (C:)
    gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
    alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsd
    agsnityrtindygaltpkmtgvme
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1klfD (D:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvptggcdvsardvtvtlpdypgsvp
    ipltvycaksqnlgyylsgttadagnsiftntasfspaqgvgvqltrngtiipanntvsl
    gavgtsavslgltanyartggqvtagnvqsiigvtfvyq
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1klfE (E:)
    gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
    alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsd
    agsnityrtindygaltpkmtgvme
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1klfF (F:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvptggcdvsardvtvtlpdypgsvp
    ipltvycaksqnlgyylsgttadagnsiftntasfspaqgvgvqltrngtiipanntvsl
    gavgtsavslgltanyartggqvtagnvqsiigvtfvyq
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1klfG (G:)
    gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
    alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsd
    agsnityrtindygaltpkmtgvme
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1klfH (H:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvptggcdvsardvtvtlpdypgsvp
    ipltvycaksqnlgyylsgttadagnsiftntasfspaqgvgvqltrngtiipanntvsl
    gavgtsavslgltanyartggqvtagnvqsiigvtfvyq
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1klfI (I:)
    gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
    alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsd
    agsnityrtindygaltpkmtgvme
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1klfJ (J:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvptggcdvsardvtvtlpdypgsvp
    ipltvycaksqnlgyylsgttadagnsiftntasfspaqgvgvqltrngtiipanntvsl
    gavgtsavslgltanyartggqvtagnvqsiigvtfvyq
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1klfK (K:)
    gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
    alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsd
    agsnityrtindygaltpkmtgvme
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1klfL (L:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvptggcdvsardvtvtlpdypgsvp
    ipltvycaksqnlgyylsgttadagnsiftntasfspaqgvgvqltrngtiipanntvsl
    gavgtsavslgltanyartggqvtagnvqsiigvtfvyq
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1klfM (M:)
    gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
    alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsd
    agsnityrtindygaltpkmtgvme
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1klfN (N:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvptggcdvsardvtvtlpdypgsvp
    ipltvycaksqnlgyylsgttadagnsiftntasfspaqgvgvqltrngtiipanntvsl
    gavgtsavslgltanyartggqvtagnvqsiigvtfvyq
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1klfO (O:)
    gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
    alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsd
    agsnityrtindygaltpkmtgvme
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1klfP (P:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvptggcdvsardvtvtlpdypgsvp
    ipltvycaksqnlgyylsgttadagnsiftntasfspaqgvgvqltrngtiipanntvsl
    gavgtsavslgltanyartggqvtagnvqsiigvtfvyq