PDB entry 1kl9

View 1kl9 on RCSB PDB site
Description: Crystal structure of the N-terminal segment of Human eukaryotic initiation factor 2alpha
Class: translation
Keywords: ob fold, helical domain, translation
Deposited on 2001-12-11, released 2002-03-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.2
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Eukaryotic translation initiation factor 2 subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05198 (Start-181)
      • cloning artifact (19)
      • cloning artifact (28)
      • cloning artifact (43)
    Domains in SCOPe 2.05: d1kl9a1, d1kl9a2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kl9A (A:)
    pglscrfyqhkfpevedvvmvnvrsiaemgayvslleynniegmillselsrrrirsink
    lirigrnecvvvirvdkekgyidlskrrvspeeaikcedkftksktvysilrhvaevley
    tkdeqleslfqrtawvfddkykrpgygaydafkhavsdpsildsldlnederevlinnin
    rr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kl9A (A:)
    lscrfyqhkfpevedvvmvnvrsiaemgayvslleynniegmillselrigrnecvvvir
    vdkekgyidlskrrvspeeaikcedkftksktvysilrhvaevleytkdeqleslfqrta
    wvfddkykrpgygaydafkhavsdpsildsldlnederevlinninrr