PDB entry 1kl8

View 1kl8 on RCSB PDB site
Description: nmr structural analysis of the complex formed between alpha-bungarotoxin and the principal alpha-neurotoxin binding sequence on the alpha7 subunit of a neuronal nicotinic acetylcholine receptor
Class: toxin
Keywords: alpha-bungarotoxin, nicotinic acetylcholine receptor alpha 7 subunit, alpha-neurotoxin, ligand-gated ion channels, nmr protein-protein interactions, protein-peptide complex
Deposited on 2001-12-11, released 2002-03-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-bungarotoxin
    Species: Bungarus multicinctus [TaxId:8616]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1kl8a_
  • Chain 'B':
    Compound: neuronal acetylcholine receptor protein, alpha-7 chain
    Species: Gallus gallus [TaxId:9031]
    Gene:
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kl8A (A:)
    ivchttatspisavtcppgenlcyrkmwcdafcssrgkvvelgcaatcpskkpyeevtcc
    stdkcnphpkqrpg
    

  • Chain 'B':
    No sequence available.