PDB entry 1kl7

View 1kl7 on RCSB PDB site
Description: crystal structure of threonine synthase from yeast
Deposited on 2001-12-11, released 2002-04-24
The last revision prior to the SCOP 1.61 freeze date was dated 2002-04-24, with a file datestamp of 2002-04-24.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.201
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1kl7a_
  • Chain 'B':
    Domains in SCOP 1.61: d1kl7b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kl7A (A:)
    pnasqvyrstrssspktisfeeaiiqglatdgglfipptipqvdqatlfndwsklsfqdl
    afaimrlyiaqeeipdadlkdlikrsystfrsdevtplvqnvtgdkenlhilelfhgpty
    afkdvalqfvgnlfeyflqrtnanlpegekkqitvvgatsgdtgsaaiyglrgkkdvsvf
    ilyptgrispiqeeqmttvpdenvqtlsvtgtfdncqdivkaifgdkefnskhnvgavns
    inwarilaqmtyyfysffqatngkdskkvkfvvpsgnfgdilagyfakkmglpieklaia
    tnendildrflksglyersdkvaatlspamdilissnferllwylareylangddlkage
    ivnnwfqelktngkfqvdksiiegaskdftservsneetsetikkiyessvnpkhyildp
    htavgvcaterliakdndksiqyislstahpakfadavnnalsgfsnysfekdvlpeelk
    klstlkkklkfieradvelvknaieeelakm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kl7A (A:)
    pnasqvyrstrssspktisfeeaiiqglatdgglfipptipqvdqatlfndwsklsfqdl
    afaimrlyiaqeeipdadlkdlikrsystfrsdevtplvqnvtgdkenlhilelfhgpty
    afkdvalqfvgnlfeyflqrtnanlpegekkqitvvgatsgdtgsaaiyglrgkkdvsvf
    ilyptgrispiqeeqmttvpdenvqtlsvtgtfdncqdivkaifgdkefnhnvgavnsin
    warilaqmtyyfysffqatngkdskkvkfvvpsgnfgdilagyfakkmglpieklaiatn
    endildrflksglyersdkvaatlspamdilissnferllwylareylangddlkageiv
    nnwfqelktngkfqvdksiiegaskdftservsneetsetikkiyessvnpkhyildpht
    avgvcaterliakdndksiqyislstahpakfadavnnalsgfsnysfekdvlpeelkkl
    stlkkklkfieradvelvknaieeelakm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kl7B (B:)
    pnasqvyrstrssspktisfeeaiiqglatdgglfipptipqvdqatlfndwsklsfqdl
    afaimrlyiaqeeipdadlkdlikrsystfrsdevtplvqnvtgdkenlhilelfhgpty
    afkdvalqfvgnlfeyflqrtnanlpegekkqitvvgatsgdtgsaaiyglrgkkdvsvf
    ilyptgrispiqeeqmttvpdenvqtlsvtgtfdncqdivkaifgdkefnskhnvgavns
    inwarilaqmtyyfysffqatngkdskkvkfvvpsgnfgdilagyfakkmglpieklaia
    tnendildrflksglyersdkvaatlspamdilissnferllwylareylangddlkage
    ivnnwfqelktngkfqvdksiiegaskdftservsneetsetikkiyessvnpkhyildp
    htavgvcaterliakdndksiqyislstahpakfadavnnalsgfsnysfekdvlpeelk
    klstlkkklkfieradvelvknaieeelakm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kl7B (B:)
    pnasqvyrstrssspktisfeeaiiqglatdgglfipptipqvdqatlfndwsklsfqdl
    afaimrlyiaqeeipdadlkdlikrsystfrsdevtplvqnvtgdkenlhilelfhgpty
    afkdvalqfvgnlfeyflqrtnanlpegekkqitvvgatsgdtgsaaiyglrgkkdvsvf
    ilyptgrispiqeeqmttvpdenvqtlsvtgtfdncqdivkaifgdkefnhnvgavnsin
    warilaqmtyyfysffqatngkdskkvkfvvpsgnfgdilagyfakkmglpieklaiatn
    endildrflksglyersdkvaatlspamdilissnferllwylareylangddlkageiv
    nnwfqelktngkfqvdksiiegaskdftservsneetsetikkiyessvnpkhyildpht
    avgvcaterliakdndksiqyislstahpakfadavnnalsgfsnysfekdvlpeelkkl
    stlkkklkfieradvelvknaieeelakm