PDB entry 1kku

View 1kku on RCSB PDB site
Description: Crystal structure of nuclear human nicotinamide mononucleotide adenylyltransferase
Class: transferase
Keywords: alpha/beta structure - Rossmann fold, TRANSFERASE
Deposited on 2001-12-10, released 2002-06-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.247
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nicotinamide mononucleotide adenylyltransferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kkua_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kkuA (A:)
    mensektevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkgl
    ipayhrvimaelatknskwvevdtweslqkewketlkvlrhhqekleasdcdhqqnsptl
    erpgrkrkwtetqdssqkkslepktkavpkvkllcgadllesfavpnlwkseditqivan
    yglicvtragndaqkfiyesdvlwkhrsnihvvnewfandisstkirralrrgqsirylv
    pdlvqeyiekhnlyssesedrnagvilaplqrntaeakt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kkuA (A:)
    ektevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkglipay
    hrvimaelatknskwvevdtweslqkewketlkvlrhhqekleasdvpkvkllcgadlle
    sfavpnlwkseditqivanyglicvtragndaqkfiyesdvlwkhrsnihvvnewfandi
    sstkirralrrgqsirylvpdlvqeyiekhnlysse