PDB entry 1kkh

View 1kkh on RCSB PDB site
Description: Crystal Structure of the Methanococcus jannaschii Mevalonate Kinase
Class: transferase
Keywords: mixed beta sheet, phosphate-binding loop, beta-alpha-beta, TRANSFERASE
Deposited on 2001-12-08, released 2002-03-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.2
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mevalonate Kinase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q58487 (5-316)
      • expression tag (0-4)
    Domains in SCOPe 2.06: d1kkha1, d1kkha2, d1kkha3
  • Heterogens: DIO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kkhA (A:)
    prgshmiietpskvilfgehavvygyraismaidltstieiketqedeiilnlndlnksl
    glnlneikninpnnfgdfkyclcaikntldylniepktgfkinisskipiscglgssasi
    tigtikavsgfynkelkddeiaklgymvekeiqgkasitdtstitykgileiknnkfrki
    kgefeeflknckflivyaekrkkktaelvnevakienkdeifkeidkvidealkiknked
    fgklmtknhellkklnistpkldrivdignrfgfgakltgaggggcviilvneekekell
    kelnkedvrifncrmmn