PDB entry 1kkd

View 1kkd on RCSB PDB site
Description: solution structure of the calmodulin binding domain (cambd) of small conductance ca2+-activated potassium channels (sk2)
Deposited on 2001-12-07, released 2001-12-14
The last revision prior to the SCOP 1.59 freeze date was dated 2002-02-08, with a file datestamp of 2002-02-08.
Experiment type: NMR23
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1kkda_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kkdA (A:)
    rkleltkaekhvhnfmmdtqltkrvknaaanvlretwliykntklvkkidhakvrkhqrk
    flqaihqlrsvkmeqrklndqantlvdlaktq