PDB entry 1kkc

View 1kkc on RCSB PDB site
Description: Crystal structure of Aspergillus fumigatus MnSOD
Deposited on 2001-12-07, released 2001-12-28
The last revision prior to the SCOP 1.59 freeze date was dated 2002-01-30, with a file datestamp of 2002-01-30.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.194
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kkcA (A:)
    qqytlpplpypydalqpyisqqimelhhkkhhqtyvnglnaaleaqkkaaeatdvpklvs
    vqqaikfnggghinhslfwknlapeksgggkidqapvlkaaieqrwgsfdkfkdafnttl
    lgiqgsgwgwlvtdgpkgkldittthdqdpvtgaapvfgvdmwehayylqylndkasyak
    giwnvinwaeaenryiagdk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kkcB (B:)
    qytlpplpypydalqpyisqqimelhhkkhhqtyvnglnaaleaqkkaaeatdvpklvsv
    qqaikfnggghinhslfwknlapeksgggkidqapvlkaaieqrwgsfdkfkdafnttll
    giqgsgwgwlvtdgpkgkldittthdqdpvtgaapvfgvdmwehayylqylndkasyakg
    iwnvinwaeaenryiagdk
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kkcX (X:)
    qytlpplpypydalqpyisqqimelhhkkhhqtyvnglnaaleaqkkaaeatdvpklvsv
    qqaikfnggghinhslfwknlapeksgggkidqapvlkaaieqrwgsfdkfkdafnttll
    giqgsgwgwlvtdgpkgkldittthdqdpvtgaapvfgvdmwehayylqylndkasyakg
    iwnvinwaeaenryiagdkg
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kkcY (Y:)
    qqytlpplpypydalqpyisqqimelhhkkhhqtyvnglnaaleaqkkaaeatdvpklvs
    vqqaikfnggghinhslfwknlapeksgggkidqapvlkaaieqrwgsfdkfkdafnttl
    lgiqgsgwgwlvtdgpkgkldittthdqdpvtgaapvfgvdmwehayylqylndkasyak
    giwnvinwaeaenryiagdk