PDB entry 1kkc

View 1kkc on RCSB PDB site
Description: Crystal structure of Aspergillus fumigatus MnSOD
Class: oxidoreductase
Keywords: Homotetramer, OXIDOREDUCTASE
Deposited on 2001-12-07, released 2001-12-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.194
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: manganese superoxide dismutase
    Species: Aspergillus fumigatus [TaxId:5085]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kkca1, d1kkca2
  • Chain 'B':
    Compound: manganese superoxide dismutase
    Species: Aspergillus fumigatus [TaxId:5085]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kkcb1, d1kkcb2
  • Chain 'X':
    Compound: manganese superoxide dismutase
    Species: Aspergillus fumigatus [TaxId:5085]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kkcx1, d1kkcx2
  • Chain 'Y':
    Compound: manganese superoxide dismutase
    Species: Aspergillus fumigatus [TaxId:5085]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kkcy1, d1kkcy2
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kkcA (A:)
    gtspiqtpintmsqqytlpplpypydalqpyisqqimelhhkkhhqtyvnglnaaleaqk
    kaaeatdvpklvsvqqaikfnggghinhslfwknlapeksgggkidqapvlkaaieqrwg
    sfdkfkdafnttllgiqgsgwgwlvtdgpkgkldittthdqdpvtgaapvfgvdmwehay
    ylqylndkasyakgiwnvinwaeaenryiagdkgghpfmkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kkcA (A:)
    qqytlpplpypydalqpyisqqimelhhkkhhqtyvnglnaaleaqkkaaeatdvpklvs
    vqqaikfnggghinhslfwknlapeksgggkidqapvlkaaieqrwgsfdkfkdafnttl
    lgiqgsgwgwlvtdgpkgkldittthdqdpvtgaapvfgvdmwehayylqylndkasyak
    giwnvinwaeaenryiagdk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kkcB (B:)
    gtspiqtpintmsqqytlpplpypydalqpyisqqimelhhkkhhqtyvnglnaaleaqk
    kaaeatdvpklvsvqqaikfnggghinhslfwknlapeksgggkidqapvlkaaieqrwg
    sfdkfkdafnttllgiqgsgwgwlvtdgpkgkldittthdqdpvtgaapvfgvdmwehay
    ylqylndkasyakgiwnvinwaeaenryiagdkgghpfmkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kkcB (B:)
    qytlpplpypydalqpyisqqimelhhkkhhqtyvnglnaaleaqkkaaeatdvpklvsv
    qqaikfnggghinhslfwknlapeksgggkidqapvlkaaieqrwgsfdkfkdafnttll
    giqgsgwgwlvtdgpkgkldittthdqdpvtgaapvfgvdmwehayylqylndkasyakg
    iwnvinwaeaenryiagdk
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1kkcX (X:)
    gtspiqtpintmsqqytlpplpypydalqpyisqqimelhhkkhhqtyvnglnaaleaqk
    kaaeatdvpklvsvqqaikfnggghinhslfwknlapeksgggkidqapvlkaaieqrwg
    sfdkfkdafnttllgiqgsgwgwlvtdgpkgkldittthdqdpvtgaapvfgvdmwehay
    ylqylndkasyakgiwnvinwaeaenryiagdkgghpfmkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kkcX (X:)
    qytlpplpypydalqpyisqqimelhhkkhhqtyvnglnaaleaqkkaaeatdvpklvsv
    qqaikfnggghinhslfwknlapeksgggkidqapvlkaaieqrwgsfdkfkdafnttll
    giqgsgwgwlvtdgpkgkldittthdqdpvtgaapvfgvdmwehayylqylndkasyakg
    iwnvinwaeaenryiagdkg
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >1kkcY (Y:)
    gtspiqtpintmsqqytlpplpypydalqpyisqqimelhhkkhhqtyvnglnaaleaqk
    kaaeatdvpklvsvqqaikfnggghinhslfwknlapeksgggkidqapvlkaaieqrwg
    sfdkfkdafnttllgiqgsgwgwlvtdgpkgkldittthdqdpvtgaapvfgvdmwehay
    ylqylndkasyakgiwnvinwaeaenryiagdkgghpfmkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kkcY (Y:)
    qqytlpplpypydalqpyisqqimelhhkkhhqtyvnglnaaleaqkkaaeatdvpklvs
    vqqaikfnggghinhslfwknlapeksgggkidqapvlkaaieqrwgsfdkfkdafnttl
    lgiqgsgwgwlvtdgpkgkldittthdqdpvtgaapvfgvdmwehayylqylndkasyak
    giwnvinwaeaenryiagdk