PDB entry 1kk9

View 1kk9 on RCSB PDB site
Description: crystal structure of e. coli ycio
Class: unknown function
Keywords: alpha/beta open twisted sheet, Montreal-Kingston Bacterial Structural Genomics Initiative, BSGI, Structural Genomics, UNKNOWN FUNCTION
Deposited on 2001-12-06, released 2002-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable translation factor yciO
    Species: Escherichia coli [TaxId:562]
    Gene: yciO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45847 (Start-220)
      • modified residue (15)
      • modified residue (64)
      • modified residue (82)
      • modified residue (103)
      • modified residue (135)
      • modified residue (154)
      • modified residue (160)
    Domains in SCOPe 2.07: d1kk9a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kk9A (A:)
    gshmgtaaehhregimsqffyihpdnpqqrlinqaveivrkggvivyptdsgyalgckie
    dknamericrirqlpdghnftlmcrdlselstysfvdnvafrlmknntpgnytfilkgtk
    evprrllqekrktigmrvpsnpiaqallealgepmlstslmlpgseftesdpeeikdrle
    kqvdliihggylgqkpttvidltddtpvvvregvgdvkpfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kk9A (A:)
    msqffyihpdnpqqrlinqaveivrkggvivyptdsgyalgckiedknamericrirqlp
    dghnftlmcrdlselstysfvdnvafrlmknntpgnytfilkgtkevprrllqekrktig
    mrvpsnpiaqallealgepmlstslmlpgseftesdpeeikdrlekqvdliihggylgqk
    pttvidltddtpvvvregvgdvkpfl