PDB entry 1kk8

View 1kk8 on RCSB PDB site
Description:
Deposited on 2001-12-06, released 2002-10-09
The last revision prior to the SCOP 1.63 freeze date was dated 2002-10-09, with a file datestamp of 2002-10-09.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.23
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1kk8a1, d1kk8a2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1kk8b_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1kk8c_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kk8A (A:)
    mnidfsdpdfqylavdrkklmkeqtaafdgkkncwvpdekegfasaeiqsskgdeitvki
    vadsstrtvkkddiqsmnppkfekledmanmtylneasvlynlrsrytsgliytysglfc
    iavnpyrrlpiytdsviakyrgkrkteipphlfsvadnayqnmvtdrenqsclitgesga
    gktentkkvimylakvacavkkkdeeasdkkegsledqiiqanpvleaygnakttrnnns
    srfgkfirihfgptgkiagadietylleksrvtyqqsaernyhifyqicsnaipelndvm
    lvtpdsglysfinqgcltvdniddveefklcdeafdilgftkeekqsmfkctasilhmge
    mkfkqrpreeqaesdgtaeaekvaflcginagdllkallkpkvkvgtemvtkgqnmnqvv
    nsvgalakslydrmfnwlvrrvnktldtkakrnyyigvldiagfeifdfnsfeqlcinyt
    nerlqqffnhhmfileqeeykkegiawefidfgmdlqmcidliekpmgilsileeecmfp
    kaddksfqdklyqnhmgknrmftkpgkptrpnqgpahfelhhyagnvpysitgwleknkd
    pinenvvallgaskeplvaelfkapeepagggkkkkgkssafqtisavhreslnklmknl
    ysthphfvrciipnelkqpglvdaelvlhqlqcngvlegiricrkgfpsrliysefkqry
    silapnaipqgfvdgktvsekilaglqmdpaeyrlgttkvffkagvlgnleemrderlsk
    iismfqahirgylirkaykklqdqriglsviqrnirkwlvlrnwqwwklyskvkpll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kk8A (A:)
    mnidfsdpdfqylavdrkklmktaafdgkkncwvpdekegfasaeiqsskgdeitvkiva
    dsstrtvkkddiqsmnppkfekledmanmtylneasvlynlrsrytsgliytysglfcia
    vnpyrrlpiytdsviakyrgkrkteipphlfsvadnayqnmvtdrenqsclitgesgagk
    tentkkvimylakvacavkkkegsledqiiqanpvleaygnakttrnnnssrfgkfirih
    fgptgkiagadietylleksrvtyqqsaernyhifyqicsnaipelndvmlvtpdsglys
    finqgcltvdniddveefklcdeafdilgftkeekqsmfkctasilhmgemkfkqeqaes
    dgtaeaekvaflcginagdllkallkpkvkmvtkgqnmnqvvnsvgalakslydrmfnwl
    vrrvnktldtkakrnyyigvldiagfeifdfnsfeqlcinytnerlqqffnhhmfileqe
    eykkegiawefidfgmdlqmcidliekpmgilsileeecmfpkaddksfqdklyqnhmgk
    nrmftkpgkptrpnqgpahfelhhyagnvpysitgwleknkdpinenvvallgaskeplv
    aelfkaqtisavhreslnklmknlysthphfvrciipnelkqpglvdaelvlhqlqcngv
    lerkgfpsrliysefkqrysilapnaipqdgktvsekilaglqmdpaeyrlgttkvffka
    gvlgnleemrderlskiismfqahirgylirkaykklqdqriglsviqrnirkwlvlrnw
    qwwklyskvkpll
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kk8B (B:)
    pqkqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltamlkeapgplnftmf
    lsifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnfnkdemrmtfkea
    pveggkfdyvkftamikgs
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kk8C (C:)
    pklsqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmge
    kslpfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsde
    dvdeiikltdlqedlegnvkyedfvkkvmagpyp