PDB entry 1kk8

View 1kk8 on RCSB PDB site
Description: SCALLOP MYOSIN (S1-ADP-BeFx) IN THE ACTIN-DETACHED CONFORMATION
Class: contractile protein
Keywords: actin-detached, Myosin, Mechanics of MOTOR, CONTRACTILE PROTEIN
Deposited on 2001-12-06, released 2002-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-01, with a file datestamp of 2016-05-27.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin heavy chain, striated muscle
    Species: Argopecten irradians [TaxId:31199]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kk8a1, d1kk8a2
  • Chain 'B':
    Compound: myosin regulatory light chain, striated adductor muscle
    Species: Argopecten irradians [TaxId:31199]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kk8b_
  • Chain 'C':
    Compound: Myosin Essential Light Chain,Striated adductor muscle
    Species: Argopecten irradians [TaxId:31199]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kk8c_
  • Heterogens: MG, CA, BEF, ADP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kk8A (A:)
    mnidfsdpdfqylavdrkklmkeqtaafdgkkncwvpdekegfasaeiqsskgdeitvki
    vadsstrtvkkddiqsmnppkfekledmanmtylneasvlynlrsrytsgliytysglfc
    iavnpyrrlpiytdsviakyrgkrkteipphlfsvadnayqnmvtdrenqsclitgesga
    gktentkkvimylakvacavkkkdeeasdkkegsledqiiqanpvleaygnakttrnnns
    srfgkfirihfgptgkiagadietylleksrvtyqqsaernyhifyqicsnaipelndvm
    lvtpdsglysfinqgcltvdniddveefklcdeafdilgftkeekqsmfkctasilhmge
    mkfkqrpreeqaesdgtaeaekvaflcginagdllkallkpkvkvgtemvtkgqnmnqvv
    nsvgalakslydrmfnwlvrrvnktldtkakrnyyigvldiagfeifdfnsfeqlcinyt
    nerlqqffnhhmfileqeeykkegiawefidfgmdlqmcidliekpmgilsileeecmfp
    kaddksfqdklyqnhmgknrmftkpgkptrpnqgpahfelhhyagnvpysitgwleknkd
    pinenvvallgaskeplvaelfkapeepagggkkkkgkssafqtisavhreslnklmknl
    ysthphfvrciipnelkqpglvdaelvlhqlqcngvlegiricrkgfpsrliysefkqry
    silapnaipqgfvdgktvsekilaglqmdpaeyrlgttkvffkagvlgnleemrderlsk
    iismfqahirgylirkaykklqdqriglsviqrnirkwlvlrnwqwwklyskvkpll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kk8A (A:)
    mnidfsdpdfqylavdrkklmktaafdgkkncwvpdekegfasaeiqsskgdeitvkiva
    dsstrtvkkddiqsmnppkfekledmanmtylneasvlynlrsrytsgliytysglfcia
    vnpyrrlpiytdsviakyrgkrkteipphlfsvadnayqnmvtdrenqsclitgesgagk
    tentkkvimylakvacavkkkegsledqiiqanpvleaygnakttrnnnssrfgkfirih
    fgptgkiagadietylleksrvtyqqsaernyhifyqicsnaipelndvmlvtpdsglys
    finqgcltvdniddveefklcdeafdilgftkeekqsmfkctasilhmgemkfkqeqaes
    dgtaeaekvaflcginagdllkallkpkvkmvtkgqnmnqvvnsvgalakslydrmfnwl
    vrrvnktldtkakrnyyigvldiagfeifdfnsfeqlcinytnerlqqffnhhmfileqe
    eykkegiawefidfgmdlqmcidliekpmgilsileeecmfpkaddksfqdklyqnhmgk
    nrmftkpgkptrpnqgpahfelhhyagnvpysitgwleknkdpinenvvallgaskeplv
    aelfkaqtisavhreslnklmknlysthphfvrciipnelkqpglvdaelvlhqlqcngv
    lerkgfpsrliysefkqrysilapnaipqdgktvsekilaglqmdpaeyrlgttkvffka
    gvlgnleemrderlskiismfqahirgylirkaykklqdqriglsviqrnirkwlvlrnw
    qwwklyskvkpll
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kk8B (B:)
    pqkqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltamlkeapgplnftmf
    lsifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnfnkdemrmtfkea
    pveggkfdyvkftamikgs
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kk8C (C:)
    pklsqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmge
    kslpfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsde
    dvdeiikltdlqedlegnvkyedfvkkvmagpyp