PDB entry 1kk0

View 1kk0 on RCSB PDB site
Description: Structure of the large gamma subunit of initiation factor eIF2 from Pyrococcus abyssi
Class: translation
Keywords: initiation of translation
Deposited on 2001-12-06, released 2002-04-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.219
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: eIF2gamma
    Species: Pyrococcus abyssi [TaxId:29292]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9V1G0 (Start-409)
      • modified residue (14)
      • modified residue (96)
      • modified residue (99)
      • modified residue (106)
      • modified residue (129)
      • modified residue (210)
      • modified residue (306)
      • modified residue (362)
    Domains in SCOPe 2.06: d1kk0a1, d1kk0a2, d1kk0a3
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kk0A (A:)
    gekrksrqaevnigmvghvdhgkttltkaltgvwtdthseelrrgitikigfadaeirrc
    pncgrystspvcpycghetefvrrvsfidapghealmttmlagaslmdgailviaanepc
    prpqtrehlmalqiigqkniiiaqnkielvdkekalenyrqikefiegtvaenapiipis
    alhganidvlvkaiedfiptpkrdpnkppkmlvlrsfdvnkpgtppeklvggvlggsivq
    gklkvgdeieirpgvpyeehgrikyepitteivslqaggqfveeaypgglvgvgtkldpy
    ltkgdlmagnvvgkpgklppvwdslrlevhllervvgteqelkvepikrkevlllnvgta
    rtmglvtglgkdeievklqipvcaepgdrvaisrqigsrwrligygiike
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kk0A (A:)
    srqaevnigmvghvdhgkttltkaltgvwtdhseelrrgitikigfadaeirrcpncgry
    stspvcpycghetefvrrvsfidapghealmttmlagaslmdgailviaanepcprpqtr
    ehlmalqiigqkniiiaqnkielvdkekalenyrqikefiegtvaenapiipisalhgan
    idvlvkaiedfiptpkrdpnkppkmlvlrsfdvnkpglvggvlggsivqgklkvgdeiei
    rpgvpyeehgrikyepitteivslqaggqfveeaypgglvgvgtkldpyltkgdlmagnv
    vgkpgklppvwdslrlevhllervvgteqelkvepikrkevlllnvgtartmglvtglgk
    deievklqipvcaepgdrvaisrqigsrwrligygiike