PDB entry 1kjy

View 1kjy on RCSB PDB site
Description: Crystal Structure of Human G[alpha]i1 Bound to the GoLoco Motif of RGS14
Class: signaling protein
Keywords: Protein-peptide complex, SIGNALING PROTEIN
Deposited on 2001-12-05, released 2002-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.238
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Guanine nucleotide-binding protein G(i), alpha-1 subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63096
      • see remark 999 (0)
    Domains in SCOPe 2.07: d1kjya1, d1kjya2, d1kjya3
  • Chain 'B':
    Compound: regulator of g-protein signaling 14
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Guanine nucleotide-binding protein G(i), alpha-1 subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63096 (0-End)
      • see remark 999 (0)
    Domains in SCOPe 2.07: d1kjyc1, d1kjyc2
  • Chain 'D':
    Compound: regulator of g-protein signaling 14
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, CS, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kjyA (A:)
    garevkllllgagesgkstivkqmkiiheagyseeeckqykavvysntiqsiiaiiramg
    rlkidfgdsaraddarqlfvlagaaeegfmtaelagvikrlwkdsgvqacfnrsreyqln
    dsaayylndldriaqpnyiptqqdvlrtrvkttgivethftfkdlhfkmfdvggqrserk
    kwihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilfln
    kkdlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdt
    knvqfvfdavtdviiknnlkdcglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kjyA (A:)
    garevkllllgagesgkstivkqmkiiheagyseeeckqykavvysntiqsiiaiiramg
    rlkidfgdsaraddarqlfvlagaaeegfmtaelagvikrlwkdsgvqacfnrsreyqln
    dsaayylndldriaqpnyiptqqdvlrtrvkttgivethftfkdlhfkmfdvggqrserk
    kwihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilfln
    kkdlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdt
    knvqfvfdavtdviiknnlk
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1kjyC (C:)
    garevkllllgagesgkstivkqmkiiheagyseeeckqykavvysntiqsiiaiiramg
    rlkidfgdsaraddarqlfvlagaaeegfmtaelagvikrlwkdsgvqacfnrsreyqln
    dsaayylndldriaqpnyiptqqdvlrtrvkttgivethftfkdlhfkmfdvggqrserk
    kwihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilfln
    kkdlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdt
    knvqfvfdavtdviiknnlkdcglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kjyC (C:)
    garevkllllgagesgkstivkqmkiiheagyseeeckqykavvysntiqsiiaiiramg
    rlkidfgdsaraddarqlfvlagaaeegfmtaelagvikrlwkdsgvqacfnrsreyqln
    dsaayylndldriaqpnyiptqqdvlrtrvkttgivethftfkdlhfkmfdvggqrserk
    kwihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilfln
    kkdlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdt
    knvqfvfdavtdviiknn
    

  • Chain 'D':
    No sequence available.