PDB entry 1kjw

View 1kjw on RCSB PDB site
Description: SH3-Guanylate Kinase Module from PSD-95
Class: neuropeptide
Keywords: protein-protein interaction, scaffold, neuropeptide
Deposited on 2001-12-05, released 2002-01-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.23
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: postsynaptic density protein 95
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kjwa1, d1kjwa2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kjwA (A:)
    gfyiralfdydktkdcgflsqalsfrfgdvlhvidagdeewwqarrvhsdsetddigfip
    skrrverrewsrlkakdwgsssgsqgredsvlsyetvtqmevhyarpiiilgptkdrand
    dllsefpdkfgscvphttrpkreyeidgrdyhfvssrekmekdiqahkfieagqynshly
    gtsvqsvrevaeqgkhcildvsanavrrlqaahlhpiaifirprslenvleinkriteeq
    arkafdratkleqeftecfsaivegdsfeeiyhkvkrviedlsgpyiwvparerl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kjwA (A:)
    gfyiralfdydktkdcgflsqalsfrfgdvlhvidagdeewwqarrvhsdsetddigfip
    skrrverrewsrlkwgsssgsqgredsvlsyetvtqmevhyarpiiilgptkdranddll
    sefpdkfgscvphttrpkreyeidgrdyhfvssrekmekdiqahkfieagqynshlygts
    vqsvrevaeqgkhcildvsanavrrlqaahlhpiaifirprslenvleinkriteeqark
    afdratkleqeftecfsaivegdsfeeiyhkvkrviedlsgpyiwvparerl