PDB entry 1kjv

View 1kjv on RCSB PDB site
Description: TAP-B-associated rat MHC class I molecule
Class: immune system
Keywords: Peptide-MHC, Major Histocompatibility Complex, IMMUNE SYSTEM
Deposited on 2001-12-05, released 2002-12-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: 0.164
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mature alpha chain of major histocompatibility complex class I antigen (HEAVY CHAIN)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1kjva1, d1kjva2
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07151 (1-99)
      • initiating met (0)
    Domains in SCOPe 2.06: d1kjvb_
  • Chain 'P':
    Compound: peptide NPR
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kjvA (A:)
    gshslryfdiavsrpglgepryisvgyvddtefarydsdaenrryqprarwmeregpeyw
    erntpiykgkeqtfrvnlrtlrgyynqseggshtiqemygcdvgsdgsllrgyeqfaydg
    rdyialnedlktwtaadfaarisrnklerdgfadlhraylegecveslrrylelgketll
    rsdppkahvtlhprpegdvtlrcwalgfypaditltwqlngedltqdmelvetrpagdgt
    fqkwasvvvplgkeqnytcrveheglpkplsqrweplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kjvA (A:)
    gshslryfdiavsrpglgepryisvgyvddtefarydsdaenrryqprarwmeregpeyw
    erntpiykgkeqtfrvnlrtlrgyynqseggshtiqemygcdvgsdgsllrgyeqfaydg
    rdyialnedlktwtaadfaarisrnklerdgfadlhraylegecveslrrylelgketll
    rsdppkahvtlhprpegdvtlrcwalgfypaditltwqlngedltqdmelvetrpagdgt
    fqkwasvvvplgkeqnytcrveheglpkplsqrwep
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kjvB (B:)
    miqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskd
    wsfyilahteftptetdvyacrvkhvtlkepktvtwdrdm
    

  • Chain 'P':
    No sequence available.