PDB entry 1kjt

View 1kjt on RCSB PDB site
Description: Crystal Structure of the GABA(A) Receptor Associated Protein, GABARAP
Class: transport protein
Keywords: ubiquitin-like fold, N-terminal alpha helical region, TRANSPORT PROTEIN
Deposited on 2001-12-05, released 2002-04-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.235
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gabarap
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1kjta_
  • Heterogens: NI, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kjtA (A:)
    asmkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvpsdltvg
    qfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdesvygl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kjtA (A:)
    mkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvpsdltvgqf
    yflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdesv