PDB entry 1kjs

View 1kjs on RCSB PDB site
Description: nmr solution structure of c5a at ph 5.2, 303k, 20 structures
Class: cell adhesion
Keywords: aggregation, chemotaxis, cell adhesion, gp agonist, c5a receptor agonist
Deposited on 1997-01-09, released 1997-05-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: c5a
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01031 (1-73)
  Domains in SCOPe 2.05: d1kjsa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kjsA (A:)
  mlqkkieeiaakykhsvvkkccydgacvnndetceqraarislgprcikafteccvvasq
  lranishkdmqlgr