PDB entry 1kjq

View 1kjq on RCSB PDB site
Description: Crystal structure of glycinamide ribonucleotide transformylase in complex with Mg-ADP
Class: transferase
Keywords: ATP-grasp, purine biosynthesis, nucleotide, TRANSFERASE
Deposited on 2001-12-05, released 2002-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: 0.19
AEROSPACI score: 0.88 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoribosylglycinamide formyltransferase 2
    Species: Escherichia coli [TaxId:562]
    Gene: PURT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kjqa1, d1kjqa2, d1kjqa3
  • Chain 'B':
    Compound: phosphoribosylglycinamide formyltransferase 2
    Species: Escherichia coli [TaxId:562]
    Gene: PURT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kjqb1, d1kjqb2, d1kjqb3
  • Heterogens: MG, NA, CL, ADP, MPO, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kjqA (A:)
    tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm
    ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltmnregirrla
    aeelqlptstyrfadseslfreavadigypcivkpvmsssgkgqtfirsaeqlaqawkya
    qqggragagrvivegvvkfdfeitlltvsavdgvhfcapvghrqedgdyreswqpqqmsp
    laleraqeiarkvvlalggyglfgvelfvcgdevifsevsprphdtgmvtlisqdlsefa
    lhvraflglpvggirqygpaasavilpqltsqnvtfdnvqnavgadlqirlfgkpeidgs
    rrlgvalataesvvdaierakhaagqvkvqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kjqA (A:)
    tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm
    ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltmnregirrla
    aeelqlptstyrfadseslfreavadigypcivkpvmskgqtfirsaeqlaqawkyaqqg
    gragagrvivegvvkfdfeitlltvsavdgvhfcapvghrqedgdyreswqpqqmsplal
    eraqeiarkvvlalggyglfgvelfvcgdevifsevsprphdtgmvtlisqdlsefalhv
    raflglpvggirqygpaasavilpqltsqnvtfdnvqnavgadlqirlfgkpeidgsrrl
    gvalataesvvdaierakhaagqvkvqg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kjqB (B:)
    tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm
    ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltmnregirrla
    aeelqlptstyrfadseslfreavadigypcivkpvmsssgkgqtfirsaeqlaqawkya
    qqggragagrvivegvvkfdfeitlltvsavdgvhfcapvghrqedgdyreswqpqqmsp
    laleraqeiarkvvlalggyglfgvelfvcgdevifsevsprphdtgmvtlisqdlsefa
    lhvraflglpvggirqygpaasavilpqltsqnvtfdnvqnavgadlqirlfgkpeidgs
    rrlgvalataesvvdaierakhaagqvkvqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kjqB (B:)
    tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm
    ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltmnregirrla
    aeelqlptstyrfadseslfreavadigypcivkpvmsgqtfirsaeqlaqawkyaqqga
    gagrvivegvvkfdfeitlltvsavdgvhfcapvghrqedgdyreswqpqqmsplalera
    qeiarkvvlalggyglfgvelfvcgdevifsevsprphdtgmvtlisqdlsefalhvraf
    lglpvggirqygpaasavilpqltsqnvtfdnvqnavgadlqirlfgkpeidgsrrlgva
    lataesvvdaierakhaagqvkvqg