PDB entry 1kjn

View 1kjn on RCSB PDB site
Description: Structure of MT0777
Class: structural genomics, unknown function
Keywords: hypotethical protein, structural genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2001-12-04, released 2002-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mth0777
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26871 (Start-156)
      • modified residue (10)
      • modified residue (63)
      • modified residue (125)
      • modified residue (152)
    Domains in SCOPe 2.07: d1kjna_
  • Chain 'B':
    Compound: mth0777
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26871 (Start-156)
      • modified residue (10)
      • modified residue (63)
      • modified residue (125)
      • modified residue (152)
    Domains in SCOPe 2.07: d1kjnb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kjnA (A:)
    mktestgkalmvlgcpespvqiplaiytshklkkkgfrvtvtanpaalrlvqvadpegiy
    tdemvdlescinelaegdyeflagfvpndaaaaylvtfagilntetlaiifdrdadvlee
    lvneimetldaeiiaarahhnpaplrvridrfmeekp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kjnA (A:)
    tgkalmvlgcpespvqiplaiytshklkkkgfrvtvtanpaalrlvqvadpegiytdemv
    dlescinelaegdyeflagfvpndaaaaylvtfagilntetlaiifdrdadvleelvnei
    metldaeiiaarahhnpaplrvridrfmeekp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kjnB (B:)
    mktestgkalmvlgcpespvqiplaiytshklkkkgfrvtvtanpaalrlvqvadpegiy
    tdemvdlescinelaegdyeflagfvpndaaaaylvtfagilntetlaiifdrdadvlee
    lvneimetldaeiiaarahhnpaplrvridrfmeekp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kjnB (B:)
    tgkalmvlgcpespvqiplaiytshklkkkgfrvtvtanpaalrlvqvadpegiytdemv
    dlescinelaegdyeflagfvpndaaaaylvtfagilntetlaiifdrdadvleelvnei
    metldaeiiaarahhnpaplrvridrfmeekp