PDB entry 1kjm

View 1kjm on RCSB PDB site
Description: TAP-A-associated rat MHC class I molecule
Class: immune system
Keywords: peptide-MHC complex, heterodimer, extracellular domain, IMMUNE SYSTEM
Deposited on 2001-12-04, released 2002-12-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.249
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RT1 class I histocompatibility antigen, AA alpha chain, heavy chain
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16391 (0-275)
      • expression tag (276)
      • expression tag (261-262)
    Domains in SCOPe 2.06: d1kjma1, d1kjma2, d1kjma3
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1kjmb_
  • Chain 'P':
    Compound: B6 Peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1KJM (0-8)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kjmA (A:)
    gshslryfytavsrpglgeprfiavgyvddtefvrfdsdaenprmeprarwmeregpeyw
    eqqtriakeweqiyrvdlrtlrgyynqseggshtiqemygcdvgsdgsllrgyrqdaydg
    rdyialnedlktwtaadfaaqitrnkweraryaerlraylegtcvewlsrylelgketll
    rsdppeahvtlhprpegdvtlrcwalgfypaditltwqlngedltqdmelvetrpagdgt
    fqkwasvvvplgkeqnytcrveheglpkplsqrwepllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kjmA (A:)
    gshslryfytavsrpglgeprfiavgyvddtefvrfdsdaenprmeprarwmeregpeyw
    eqqtriakeweqiyrvdlrtlrgyynqseggshtiqemygcdvgsdgsllrgyrqdaydg
    rdyialnedlktwtaadfaaqitrnkweraryaerlraylegtcvewlsrylelgketll
    rsdppeahvtlhprpegdvtlrcwalgfypaditltwqlngedltqdmelvetrpagdgt
    fqkwasvvvplgkeqnytcrveheglpkplsqrwepl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kjmB (B:)
    miqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskd
    wsfyilahteftptetdvyacrvkhvtlkepktvtwdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kjmB (B:)
    iqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskdw
    sfyilahteftptetdvyacrvkhvtlkepktvtwdrdm
    

  • Chain 'P':
    No sequence available.