PDB entry 1kjm

View 1kjm on RCSB PDB site
Description: TAP-A-associated rat MHC class I molecule
Deposited on 2001-12-04, released 2002-12-18
The last revision prior to the SCOP 1.71 freeze date was dated 2004-01-13, with a file datestamp of 2004-01-13.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.249
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kjmA (A:)
    gshslryfytavsrpglgeprfiavgyvddtefvrfdsdaenprmeprarwmeregpeyw
    eqqtriakeweqiyrvdlrtlrgyynqseggshtiqemygcdvgsdgsllrgyrqdaydg
    rdyialnedlktwtaadfaaqitrnkweraryaerlraylegtcvewlsrylelgketll
    rsdppeahvtlhprpegdvtlrcwalgfypaditltwqlngedltqdmelvetrpagdgt
    fqkwasvvvplgkeqnytcrveheglpkplsqrwepllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kjmA (A:)
    gshslryfytavsrpglgeprfiavgyvddtefvrfdsdaenprmeprarwmeregpeyw
    eqqtriakeweqiyrvdlrtlrgyynqseggshtiqemygcdvgsdgsllrgyrqdaydg
    rdyialnedlktwtaadfaaqitrnkweraryaerlraylegtcvewlsrylelgketll
    rsdppeahvtlhprpegdvtlrcwalgfypaditltwqlngedltqdmelvetrpagdgt
    fqkwasvvvplgkeqnytcrveheglpkplsqrwepl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kjmB (B:)
    miqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskd
    wsfyilahteftptetdvyacrvkhvtlkepktvtwdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kjmB (B:)
    iqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskdw
    sfyilahteftptetdvyacrvkhvtlkepktvtwdrdm